PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 409aa    MW: 45162.5 Da    PI: 6.3786
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010504genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box171.3e-054772530
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedCl 30
                C++++ ++++  C d++  lC+ C 
  Cla010504 47 LCDKCNAQPAIVRCMDDKLSLCQGCD 72
               7************************7 PP

2CCT62.81.1e-21353396144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R++a++RY+eK+ktR F K+irY+sRKa+A++R+RvKGrFvk+ 
  Cla010504 353 RDKAKMRYNEKKKTRTFGKQIRYASRKARADTRKRVKGRFVKAG 396
                899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.503147IPR000315B-box-type zinc finger
SMARTSM003361.1E-7147IPR000315B-box-type zinc finger
CDDcd000210.00226335No hitNo description
PfamPF062031.2E-16353395IPR010402CCT domain
PROSITE profilePS5101714.684353395IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MEPLCEFCGV VRAVVYCKSD SARLCLHCDG RVHSANSLSR RHLRSLLCDK CNAQPAIVRC  60
MDDKLSLCQG CDWNSANACS SLAHPSQVLH SYSGCPSIPD FSRIWSSVLH SPSSSSPTSL  120
PTPHHSPNFN DLQTSSSKFH PWISPPPPSL FSPHPSYHLP FSTPQPTFLA DHSNLPKGCS  180
DFKDHDNTDI CEGLNLDDVS LDLENGEELF GCPQGTMKCQ FEDGELDCLL MEKNFFSVTE  240
SNAPPLDNTI EDSSSGQQEF MGFQSSQDGL SMNMIQNGNS NCMLMNPSCN GNINIGFPTG  300
QVHSSISLSL SNITGESTAA DYQDCGLSPA FLTETSWDPS MEAIGPQAKD RNRDKAKMRY  360
NEKKKTRTFG KQIRYASRKA RADTRKRVKG RFVKAGEAYD YDPLVTRNF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819161e-106LN681916.1 Cucumis melo genomic scaffold, anchoredscaffold00037.
GenBankLN7132651e-106LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004151929.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11
RefseqXP_011650020.10.0PREDICTED: putative zinc finger protein CONSTANS-LIKE 11
TrEMBLA0A0A0LMY70.0A0A0A0LMY7_CUCSA; Uncharacterized protein
STRINGGLYMA12G32221.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70521923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.18e-83B-box type zinc finger protein with CCT domain